LCN12 Antibody - N-terminal region : HRP

LCN12 Antibody - N-terminal region : HRP
SKU
AVIARP58489_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCN12

Key Reference: Suzuki,K., Gene 339, 49-59 (2004)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LCN12 protein EMBL AAH41168.1

Protein Size: 355

Purification: Affinity Purified
More Information
SKU AVIARP58489_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58489_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 286256
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×