Ldlrap1 Antibody - C-terminal region : Biotin

Ldlrap1 Antibody - C-terminal region : Biotin
SKU
AVIARP55309_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Ldlrap1 is an adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). It may be required for LDL binding and internalization but not for receptor clustering in coated pits. It may facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits. Ldlrap1 may also be involved in the internalization of other LDLR family members. Ldlrap1 binds to phosphoinositides, which regulate clathrin bud assembly at the cell surface.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ldlrap1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: APLSTVSANTNNVDETPRPQVLGNNSVVWELDDGLDEAFSRLAQSRTNPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 264

Purification: Affinity Purified
More Information
SKU AVIARP55309_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55309_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 100017
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×