LEMD2 Antibody - middle region : FITC

LEMD2 Antibody - middle region : FITC
SKU
AVIARP55791_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LEMD2 is involved in nuclear structure organization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LEMD2

Key Reference: Otsuki,T., (2005) DNA Res. 12 (2), 117-126

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LEM domain-containing protein 2

Protein Size: 503

Purification: Affinity Purified
More Information
SKU AVIARP55791_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55791_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221496
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×