LGALS1 Antibody - middle region : FITC

LGALS1 Antibody - middle region : FITC
SKU
AVIARP58491_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LGALS1

Key Reference: Bi,S., (2008) J. Biol. Chem. 283 (18), 12248-12258

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: galectin-1

Protein Size: 135

Purification: Affinity Purified
More Information
SKU AVIARP58491_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58491_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 3956
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×