LGALS3BP Antibody - middle region : Biotin

LGALS3BP Antibody - middle region : Biotin
SKU
AVIARP54779_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LGALS3BP

Key Reference: Lee,Y.J., Clin. Exp. Rheumatol. 25 (4 SUPPL 45), S41-S45 (2007)

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: galectin-3-binding protein

Protein Size: 585

Purification: Affinity Purified
More Information
SKU AVIARP54779_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54779_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3959
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×