LOC284009 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of LOC284009 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC284009

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: IRCGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVPFLAQGIPDI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein LOC284009 EMBL AAH93711.1

Protein Size: 157

Purification: Affinity Purified

• SKU: AVIARP54457_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54457_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 284009
• Host: Rabbit