LOH11CR2A Antibody - N-terminal region : FITC

LOH11CR2A Antibody - N-terminal region : FITC
SKU
AVIARP55093_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LOH11CR2A may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOH11CR2A

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: TLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: von Willebrand factor A domain-containing protein 5A

Protein Size: 786

Purification: Affinity Purified
More Information
SKU AVIARP55093_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55093_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4013
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×