LRP1 Antibody - middle region : FITC

LRP1 Antibody - middle region : FITC
SKU
AVIARP58562_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRP1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prolow-density lipoprotein receptor-related protein 1

Protein Size: 439

Purification: Affinity Purified
More Information
SKU AVIARP58562_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58562_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 4035
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×