LRP1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRP1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Prolow-density lipoprotein receptor-related protein 1

Protein Size: 439

Purification: Affinity Purified

• SKU: AVIARP58562_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58562_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 4035
• Host: Rabbit
• Conjugate: Conjugated, HRP