LRRC57 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of LRRC57 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC57

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leucine-rich repeat-containing protein 57

Protein Size: 239

Purification: Affinity Purified

• SKU: AVIARP55577_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55577_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 255252
• Host: Rabbit