LRRFIP1 Antibody - middle region : FITC

LRRFIP1 Antibody - middle region : FITC
SKU
AVIARP59016_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. LRRFIP1 may control smooth muscle cells proliferation following artery injury through PDGFA repression. LRRFIP1 may also bind double-stranded RNA.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LRRFIP1

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: ERQKEFFDSVRSERDDLREEVVMLKEELKKHGIILNSEIATNGETSDTLN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat flightless-interacting protein 1 Ensembl ENSP00000310109

Protein Size: 640

Purification: Affinity Purified
More Information
SKU AVIARP59016_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59016_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9208
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×