LRWD1 Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of RAT LOC304396

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: EPLHFLQCHSRNNSPKDLETQLWACAFEPAREEGHSGATSQTVATCGGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: leucine-rich repeat and WD repeat-containing protein 1

Protein Size: 416

Purification: Affinity Purified

• SKU: AVIARP55558_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55558_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 304396
• Host: Rabbit