LSM14A Antibody - middle region : HRP

LSM14A Antibody - middle region : HRP
SKU
AVIARP55288_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LSM14A

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein LSM14 homolog A

Protein Size: 463

Purification: Affinity Purified
More Information
SKU AVIARP55288_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55288_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26065
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×