LTB4DH Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LTB4DH

Key Reference: Chou,W.L., (2007) J. Biol. Chem. 282 (25), 18162-18172

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Prostaglandin reductase 1

Protein Size: 329

Purification: Affinity Purified

• SKU: AVIARP54865_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54865_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22949
• Host: Rabbit