LUC7L Antibody - middle region : HRP

LUC7L Antibody - middle region : HRP
SKU
AVIARP57816_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LUC7L

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LUC7-like (S. cerevisiae) EMBL CAM26672.1

Protein Size: 325

Purification: Affinity Purified
More Information
SKU AVIARP57816_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57816_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55692
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×