LUC7L Antibody - N-terminal region : Biotin

LUC7L Antibody - N-terminal region : Biotin
SKU
AVIARP57815_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LUC7L

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative RNA-binding protein Luc7-like 1

Protein Size: 371

Purification: Affinity Purified
More Information
SKU AVIARP57815_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57815_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55692
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×