LUM Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LUM

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: AFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lumican

Protein Size: 338

Purification: Affinity Purified

• SKU: AVIARP54695_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54695_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4060
• Host: Rabbit