Lyrm4 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Lyrm4 is required for nuclear and mitochondrial iron-sulfur protein biosynthesis.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LYR motif-containing protein 4

Protein Size: 91

Purification: Affinity Purified

• SKU: AVIARP57407_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57407_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 380840
• Host: Rabbit