MAB21L1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders. There is evidence that this gene has 2 transcripts with alternate polyA sites, but the full length nature of the longer transcript has not been defined. Sequence Note: The sequence U38810.1 is a chimeric mRNA clone. Only the mab-21-like protein 1 region was propagated into this RefSeq record.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAB21L1

Key Reference: Smith,M., (2002) Cytogenet. Genome Res. 98 (4), 233-239

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein mab-21-like 1

Protein Size: 359

Purification: Affinity Purified

• SKU: AVIARP54782_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54782_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4081
• Host: Rabbit