MAFB Antibody - C-terminal region : Biotin

MAFB Antibody - C-terminal region : Biotin
SKU
AVIARP58149_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: MAFB is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAFB

Key Reference: Gemelli,C., (2006) Cell Death Differ. 13 (10), 1686-1696

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor MafB

Protein Size: 323

Purification: Affinity Purified
More Information
SKU AVIARP58149_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58149_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9935
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×