MAGEB2 Antibody - N-terminal region : HRP

MAGEB2 Antibody - N-terminal region : HRP
SKU
AVIARP56336_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB2

Key Reference: Milutinovic,S., (2007) Carcinogenesis 28 (3), 560-571

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Melanoma-associated antigen B2

Protein Size: 319

Purification: Affinity Purified
More Information
SKU AVIARP56336_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56336_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4113
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×