MAGEB3 Antibody - N-terminal region : HRP

MAGEB3 Antibody - N-terminal region : HRP
SKU
AVIARP56338_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognized on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB3

Key Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Melanoma-associated antigen B3

Protein Size: 346

Purification: Affinity Purified
More Information
SKU AVIARP56338_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56338_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4114
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×