Magee1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen E1

Protein Size: 724

Purification: Affinity Purified

• SKU: AVIARP57492_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57492_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 107528
• Host: Rabbit