MAN2B2 Antibody : Biotin

MAN2B2 Antibody : Biotin
SKU
AVIARP55216_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence QEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNG

Molecular Weight: 114 kDa

Peptide Sequence: Synthetic peptide located within the following region: QEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epididymis-specific alpha-mannosidase

Protein Size: 1009

Purification: Affinity Purified
More Information
SKU AVIARP55216_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55216_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Zebrafish
Clonality Polyclonal
Human Gene ID 23324
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×