MAN2B2 Antibody : HRP

Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence QEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNG

Molecular Weight: 114 kDa

Peptide Sequence: Synthetic peptide located within the following region: QEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Epididymis-specific alpha-mannosidase

Protein Size: 1009

Purification: Affinity Purified

• SKU: AVIARP55216_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55216_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Zebrafish
• Clonality: Polyclonal
• Human Gene ID: 23324
• Host: Rabbit