Map1lc3a Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Map1lc3a is a light chain subunit of MAP1A and MAP1B microtubule-associated proteins; It mediates interactions between microtubules and the cytoskeleton.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Map1lc3a

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: CKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Microtubule-associated proteins 1A/1B light chain 3A

Protein Size: 121

Purification: Affinity Purified

• SKU: AVIARP58917_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58917_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 362245
• Host: Rabbit
• Conjugate: Conjugated, HRP