MAP7D1 Antibody - N-terminal region : FITC

MAP7D1 Antibody - N-terminal region : FITC
SKU
AVIARP57105_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAP7D1

Key Reference: Kleiderlein,J.J., (1998) Hum. Genet. 103 (6), 666-673

Molecular Weight: 93kDa

Peptide Sequence: Synthetic peptide located within the following region: RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAP7 domain-containing protein 1

Protein Size: 841

Purification: Affinity Purified
More Information
SKU AVIARP57105_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57105_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55700
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×