Mapk10 Antibody - N-terminal region : HRP

Mapk10 Antibody - N-terminal region : HRP
SKU
AVIARP57728_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mapk10 is a stress-activated protein kinase.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: JNK3 protein EMBL ABD24063.1

Protein Size: 426

Purification: Affinity Purified
More Information
SKU AVIARP57728_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57728_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25272
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×