MAPK11 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The encoded protein can be activated by proinflammatory cytokines and environmental stresses through phosphorylation by mitogen activated protein kinase kinases (MKKs). Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MK11

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: mitogen-activated protein kinase 11

Protein Size: 364

Purification: Affinity Purified

• SKU: AVIARP56437_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56437_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5600
• Host: Rabbit