Mapk12 Antibody - C-terminal region : HRP

Mapk12 Antibody - C-terminal region : HRP
SKU
AVIARP56536_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mapk12 responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating downstream targets. Mapk12 plays a role in myoblast differentiation and also in the down-regulation of cyclin D1 in response to hypoxia in adrenal cells suggesting MAPK12 may inhibit cell proliferation while promoting differentiation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: ERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitogen-activated protein kinase 12

Protein Size: 367

Purification: Affinity Purified
More Information
SKU AVIARP56536_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56536_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29857
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×