MAPK13 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK13

Key Reference: Zhou,X., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5620-5625

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 13

Protein Size: 365

Purification: Affinity Purified

• SKU: AVIARP56440_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56440_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5603
• Host: Rabbit