MAPK4 Antibody - middle region : Biotin

MAPK4 Antibody - middle region : Biotin
SKU
AVIARP56433_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targe

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK4

Key Reference: Murtagh,J.J. (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (19), 6870-6875

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 4

Protein Size: 587

Purification: Affinity Purified
More Information
SKU AVIARP56433_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56433_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5596
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×