MARK3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MARK3 is involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MARK3

Key Reference: Murphy,J.M., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (36), 14336-14341

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAP/microtubule affinity-regulating kinase 3

Protein Size: 729

Purification: Affinity Purified

• SKU: AVIARP56343_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56343_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4140
• Host: Rabbit