MAT2B Antibody - N-terminal region : Biotin

MAT2B Antibody - N-terminal region : Biotin
SKU
AVIARP55849_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: MAT2B belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT.The protein encoded by this gene belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAT2B

Key Reference: Ramani,K., (2008) Hepatology 47 (2), 521-531

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ76904, highly similar to Homo sapiens methionine adenosyltransferase II, beta (MAT2B), transcript variant 2, mRNA EMBL BAF84608.1

Protein Size: 323

Purification: Affinity Purified

Subunit: beta
More Information
SKU AVIARP55849_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55849_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27430
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×