MATN3 Antibody - middle region : Biotin

MATN3 Antibody - middle region : Biotin
SKU
AVIARP56345_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains two

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MATN3

Key Reference: Fresquet,M., Hum. Mutat. 29 (2), 330 (2008)

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Matrilin-3

Protein Size: 486

Purification: Affinity Purified
More Information
SKU AVIARP56345_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56345_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4148
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×