MEAK7 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1609

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: LSAQENFQFDKMEVWAVGDPSEEQLAKGNKSILDADPEAQALLEISGHSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TLD domain-containing protein 1

Protein Size: 456

Purification: Affinity Purified

• SKU: AVIARP57504_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57504_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57707
• Host: Rabbit