MED14 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED14

Molecular Weight: 160kDa

Peptide Sequence: Synthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mediator of RNA polymerase II transcription subunit 14

Protein Size: 1454

Purification: Affinity Purified

Subunit: 14

• SKU: AVIARP58139_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58139_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rabbit
• Clonality: Polyclonal
• Application: Western Blotting, Chromatin Immunoprecipitation (ChIP)
• Human Gene ID: 9282
• Host: Rabbit