Med19 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMID

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription, subunit 19 homolog (Yeast) (Predicted) EMBL EDL79310.1

Protein Size: 244

Purification: Affinity Purified

Subunit: 19

• SKU: AVIARP55595_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55595_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 311165
• Host: Rabbit