Med31 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Med31

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: YEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNTTAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription, subunit 31 homolog (Yeast) (Predicted) EMBL EDM05096.1

Protein Size: 131

Purification: Affinity Purified

Subunit: 31

• SKU: AVIARP56821_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56821_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 287475
• Host: Rabbit