MED31 Antibody - N-terminal region : Biotin

MED31 Antibody - N-terminal region : Biotin
SKU
AVIARP56820_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MED31

Key Reference: Cavdar (er) World J Surg (2008) In press

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 31

Protein Size: 131

Purification: Affinity Purified

Subunit: 31
More Information
SKU AVIARP56820_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56820_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 51003
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×