MED31 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MED31

Key Reference: Cavdar (er) World J Surg (2008) In press

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 31

Protein Size: 131

Purification: Affinity Purified

Subunit: 31

• SKU: AVIARP56820_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56820_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Chromatin Immunoprecipitation (ChIP)
• Human Gene ID: 51003
• Host: Rabbit