MEIOB Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MEIOB

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: ANILLNFIRENKETNVLDDEIDSYFKESINLSTIVDVYTVEQLKGKALKN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Meiosis-specific with OB domain-containing protein Ensembl ENSP00000390778 Ensembl ENSP00000314484

Protein Size: 471

Purification: Affinity Purified

• SKU: AVIARP55533_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55533_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 254528
• Host: Rabbit