Memo1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Memo1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Memo1 is a mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization.

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: KLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein MEMO1

Protein Size: 297

Purification: Affinity Purified

• SKU: AVIARP56787_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56787_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 298787
• Host: Rabbit