MERTK Antibody - N-terminal region : FITC

MERTK Antibody - N-terminal region : FITC
SKU
AVIARP59019_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MERTK

Key Reference: N/A

Molecular Weight: 109kDa

Peptide Sequence: Synthetic peptide located within the following region: PEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tyrosine-protein kinase Mer

Protein Size: 999

Purification: Affinity purified
More Information
SKU AVIARP59019_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59019_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10461
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×