METTL5 Antibody - N-terminal region : Biotin

METTL5 Antibody - N-terminal region : Biotin
SKU
AVIARP54981_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: METTL5 is a probable methyltransferase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human METTL5

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methyltransferase-like protein 5

Protein Size: 209

Purification: Affinity Purified
More Information
SKU AVIARP54981_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54981_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29081
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×