MFAP2 Antibody - N-terminal region : FITC

MFAP2 Antibody - N-terminal region : FITC
SKU
AVIARP56961_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MFAP2

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Microfibrillar-associated protein 2

Protein Size: 183

Purification: Affinity Purified
More Information
SKU AVIARP56961_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56961_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4237
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×