MFN1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MFN1

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: SVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitofusin-1

Protein Size: 370

Purification: Affinity Purified

• SKU: AVIARP57701_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57701_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55669
• Host: Rabbit