MFSD3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MFSD3

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LKLAWAPLVDAQGSARAWVTRSTAGLGLVCGLLAGLPPPGAGQAGLPAAV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Major facilitator superfamily domain-containing protein 3

Protein Size: 412

Purification: Affinity purified

• SKU: AVIARP58372_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58372_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 113655
• Host: Rabbit
• Conjugate: Conjugated, Biotin