MFSD8 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The protein likely localizes to lysosomal membranes. Mutations in this gene are correlated with a variant form of late infantile-onset neuronal ceroid lipofuscinoses (vLINCL).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MFSD8

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Major facilitator superfamily domain-containing protein 8

Protein Size: 518

Purification: Affinity Purified

• SKU: AVIARP55547_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55547_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 256471
• Host: Rabbit