MGC33407 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC33407

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: DHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Actin-like protein 9

Protein Size: 416

Purification: Affinity Purified

• SKU: AVIARP55773_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55773_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 284382
• Host: Rabbit